Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL5B Peptide - middle region

ARL5B Peptide - middle region

Product Specifications

Product Name Alternative

ARL8

UniProt

Q96KC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL5B Rabbit Polyclonal Antibody (orb55791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_848930.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mill2 Protein Vector (Mouse) (pPB-C-His)
PV200902 500 ng

Mill2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
3- (1,3-Dioxaindan-5-yloxy) propan-1-ol
XJA22825-01 250 mg

3- (1,3-Dioxaindan-5-yloxy) propan-1-ol

Sign In for Pricing
View Details
3- (1,3-Dioxaindan-5-yloxy) propan-1-ol
XJA22825-02 2.5 g

3- (1,3-Dioxaindan-5-yloxy) propan-1-ol

Sign In for Pricing
View Details
Lentiviral mouse Kcnc1 shRNA (UAS) - Lentiviral mouse Kcnc1 shRNA (UAS, RFP) (100)
GTR15243024 1 Vial

Lentiviral mouse Kcnc1 shRNA (UAS) - Lentiviral mouse Kcnc1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PD123319 (RAAS inhibitor)
SD0006-5mg 5 mg

PD123319 (RAAS inhibitor)

Sign In for Pricing
View Details
BRS3
308262-01 50 µL

BRS3

Sign In for Pricing
View Details