Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL5B Peptide - middle region

ARL5B Peptide - middle region

Product Specifications

Product Name Alternative

ARL8

UniProt

Q96KC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL5B Rabbit Polyclonal Antibody (orb55791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_848930.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A8 Rabbit pAb
MBS8549854-01 0.1 mL

S100A8 Rabbit pAb

Sign In for Pricing
View Details
S100A8 Rabbit pAb
MBS8549854-02 0.1 mL (AF405L)

S100A8 Rabbit pAb

Sign In for Pricing
View Details
S100A8 Rabbit pAb
MBS8549854-03 0.1 mL (AF405S)

S100A8 Rabbit pAb

Sign In for Pricing
View Details
S100A8 Rabbit pAb
MBS8549854-04 0.1 mL (AF610)

S100A8 Rabbit pAb

Sign In for Pricing
View Details
S100A8 Rabbit pAb
MBS8549854-05 0.1 mL (AF635)

S100A8 Rabbit pAb

Sign In for Pricing
View Details
S100A8 Rabbit pAb
MBS8549854-06 0.1 mL (APC)

S100A8 Rabbit pAb

Sign In for Pricing
View Details