Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX18 Peptide - C-terminal region

DDX18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MrDb

UniProt

Q9NVP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX18 Rabbit Polyclonal Antibody (orb589368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006764.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPQVALSFGFKVPPFVDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium Formate
IN11648-01 100 g

Calcium Formate

Sign In for Pricing
View Details
Calcium Formate
IN11648-02 500 g

Calcium Formate

Sign In for Pricing
View Details
Calcium Formate
IN11648-03 2.5 Kg

Calcium Formate

Sign In for Pricing
View Details
Calcium Formate
IN11648-04 25 Kg

Calcium Formate

Sign In for Pricing
View Details
DDX3Y Antibody
CSB-PA947616 100 µL

DDX3Y Antibody

Sign In for Pricing
View Details
Boc-Ser(Val-Fmoc)-OH
B-3980.0005 5.0g

Boc-Ser(Val-Fmoc)-OH

Sign In for Pricing
View Details