Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX18 Peptide - C-terminal region

DDX18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MrDb

UniProt

Q9NVP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX18 Rabbit Polyclonal Antibody (orb589368) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006764.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPQVALSFGFKVPPFVDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR1A Antibody - middle region (ARP76962_P050)
ARP76962_P050 100 µL

ACTR1A Antibody - middle region (ARP76962_P050)

Sign In for Pricing
View Details
Feline Calicivirus Antibody
OAEF00538-1MG 1 mg

Feline Calicivirus Antibody

Sign In for Pricing
View Details
PTPRCAP Lentiviral Activation Particles (h2)
sc-409668-LAC-2 200 µL

PTPRCAP Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Human C-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit
MBS2887671-01 48 Well

Human C-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit

Sign In for Pricing
View Details
Human C-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit
MBS2887671-02 96 Well

Human C-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit

Sign In for Pricing
View Details
Human C-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit
MBS2887671-03 5x 96 Well

Human C-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit

Sign In for Pricing
View Details