Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPM2AIP1 Peptide - C-terminal region

EPM2AIP1 Peptide - C-terminal region

Product Specifications

UniProt

Q7L775

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPM2AIP1 Rabbit Polyclonal Antibody (orb589400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055620.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppfia2 Mouse shRNA Plasmid (Locus ID 327814)
TR508402 1 Kit

Ppfia2 Mouse shRNA Plasmid (Locus ID 327814)

Sign In for Pricing
View Details
Mouse YAF2 shRNA Plasmid
abx975948-01 150 µg

Mouse YAF2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse YAF2 shRNA Plasmid
abx975948-02 300 µg

Mouse YAF2 shRNA Plasmid

Sign In for Pricing
View Details
HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (AP)
MBS6421051-01 0.1 mL

HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (AP)

Sign In for Pricing
View Details
HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (AP)
MBS6421051-02 5x 0.1 mL

HMGB4 (High Mobility Group Protein B4, dJ1007G16.5) (AP)

Sign In for Pricing
View Details
ATP6V1G2 (NM_138282) Human Tagged ORF Clone
RG220723 10 µg

ATP6V1G2 (NM_138282) Human Tagged ORF Clone

Sign In for Pricing
View Details