Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPM2AIP1 Peptide - C-terminal region

EPM2AIP1 Peptide - C-terminal region

Product Specifications

UniProt

Q7L775

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPM2AIP1 Rabbit Polyclonal Antibody (orb589400) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055620.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Traf3ip3 3'UTR GFP Stable Cell Line
TU171022 1.0 mL

Traf3ip3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Hypocrellin B
540208 5.0mg

Hypocrellin B

Sign In for Pricing
View Details
Gpr158 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4260105 3x 1.0 µg

Gpr158 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
APC Anti-Mouse CD38 (NIMR5)
APC-30020-01 50 Tests

APC Anti-Mouse CD38 (NIMR5)

Sign In for Pricing
View Details
APC Anti-Mouse CD38 (NIMR5)
APC-30020-02 100 Tests

APC Anti-Mouse CD38 (NIMR5)

Sign In for Pricing
View Details
Lpcat4 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6471904 1.0 µg DNA

Lpcat4 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details