Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA1 Peptide - C-terminal region

GSTA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GST2, GTH1, GSTA1-1, GST-epsilon

UniProt

P08263

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTA1 Rabbit Polyclonal Antibody (orb589445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_665683.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Aconitase 2 ELISA Kit
MBS724407-01 48 Well

Guinea pig Aconitase 2 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aconitase 2 ELISA Kit
MBS724407-02 96 Well

Guinea pig Aconitase 2 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aconitase 2 ELISA Kit
MBS724407-03 5x 96 Well

Guinea pig Aconitase 2 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aconitase 2 ELISA Kit
MBS724407-04 10x 96 Well

Guinea pig Aconitase 2 ELISA Kit

Sign In for Pricing
View Details
6-Bromo-1,3-benzodioxole-5-carbonitrile
sc-311230A 5 mg

6-Bromo-1,3-benzodioxole-5-carbonitrile

Sign In for Pricing
View Details
Lentiviral mouse Sh3d19 shRNA (UAS) - Lentiviral mouse Sh3d19 shRNA (UAS, RFP) (100)
GTR15196548 1 Vial

Lentiviral mouse Sh3d19 shRNA (UAS) - Lentiviral mouse Sh3d19 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details