APPL1 Peptide - middle region
APPL1 Peptide - middle region
Product Specifications
Product Name Alternative
APPL, DIP13alpha
UniProt
Q9UKG1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APPL1 Rabbit Polyclonal Antibody (orb589729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_036228.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DQPGQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1192067-01 0.02 mg (E-Coli)
Recombinant Human Putative serine protease 56 (PRSS56)
Sign In for Pricing
View Details MBS1192067-02 0.1 mg (E-Coli)
Recombinant Human Putative serine protease 56 (PRSS56)
Sign In for Pricing
View Details MBS1192067-03 1 mg (E-Coli)
Recombinant Human Putative serine protease 56 (PRSS56)
Sign In for Pricing
View Details MBS1192067-04 5x 1 mg (E-Coli)
Recombinant Human Putative serine protease 56 (PRSS56)
Sign In for Pricing
View Details