Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR3 Peptide - C-terminal region

SSTR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SS3R, SS3-R, SS-3-R, SSR-28

UniProt

P32745

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SSTR3 Rabbit Polyclonal Antibody (orb589731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001042.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2A1 Antibody
orb2808785 100 µL

BCL2A1 Antibody

Sign In for Pricing
View Details
Spry1 Rabbit mAb
C05850-20uL 20 µL

Spry1 Rabbit mAb

Sign In for Pricing
View Details
Aldose-reductase, Human (His)
HY-P701973 1 Each

Aldose-reductase, Human (His)

Sign In for Pricing
View Details
Human GITR Recombinant Protein C-Fc Tag Lyophilized 50UG
IHUGITRRCFCLY50UG 50 µg

Human GITR Recombinant Protein C-Fc Tag Lyophilized 50UG

Sign In for Pricing
View Details
CD68 (9H5) Mouse Monoclonal Antibody
AMM03338-01 50 µL

CD68 (9H5) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD68 (9H5) Mouse Monoclonal Antibody
AMM03338-02 100 µL

CD68 (9H5) Mouse Monoclonal Antibody

Sign In for Pricing
View Details