SSTR3 Peptide - C-terminal region
SSTR3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SS3R, SS3-R, SS-3-R, SSR-28
UniProt
P32745
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SSTR3 Rabbit Polyclonal Antibody (orb589731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001042.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472987-500 1x 500 µL
Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040791-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880709-500 1x 500 µL
Human Kappa Light Chain (KLC709), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040896-100 1x 100 µL
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683150-100 1x 100 µL
Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 