RBM12B Peptide - middle region
RBM12B Peptide - middle region
Product Specifications
Product Name Alternative
MGC:33837
UniProt
Q8IXT5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RBM12B Rabbit Polyclonal Antibody (orb55803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_976324.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKDPPIYSVGAFENFRHQLEDLRQLDNFKHPQRDFRQPDRHPPEDFRHSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP14949PU-N 400 µL
PI 3 Kinase p85 beta (PIK3R2) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![5-(Formylamino)-2-[[4-(formylamino)phenyl]sulfonyl]benzenesulfonamide](https://cdn.genprice.uk/products/572/6836196750010/imageurl/trc-f818420-10mg.webp)
TRC-F818420-10MG 10 mg
5-(Formylamino)-2-[[4-(formylamino)phenyl]sulfonyl]benzenesulfonamide
Sign In for Pricing
View Details 
![THTPA Mouse Monoclonal Antibody [Clone ID: OTI3H7]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907e34/imageurl/cf806047.webp)
![PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody[G025H7]](https://cdn.genprice.uk/products/763/68dd14ad061270361e7d31c0/imageurl/e-ab-f1156h.webp)
E-AB-F1156H-01 20 Tests
PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody[G025H7]
Sign In for Pricing
View Details