Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM12B Peptide - middle region

RBM12B Peptide - middle region

Product Specifications

Product Name Alternative

MGC:33837

UniProt

Q8IXT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM12B Rabbit Polyclonal Antibody (orb55803) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_976324.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKDPPIYSVGAFENFRHQLEDLRQLDNFKHPQRDFRQPDRHPPEDFRHSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (CCNB1) Human Gene Knockout Kit (CRISPR)
KN400812 1 Kit

Cyclin B1 (CCNB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(+)-19-Norandrost-4-ene-3,17-dione
TRC-N661000-10G 10 g

(+)-19-Norandrost-4-ene-3,17-dione

Sign In for Pricing
View Details
(2a,3b)-2,3-Dihydroxy-urs-12-en-28-oic Acid
TRC-C695600-50MG 50 mg

(2a,3b)-2,3-Dihydroxy-urs-12-en-28-oic Acid

Sign In for Pricing
View Details
CD37 (NM_001774) Human Over-expression Lysate
LC419751 20 µg

CD37 (NM_001774) Human Over-expression Lysate

Sign In for Pricing
View Details
IL36RN Mouse
OM296370-01 10 µg

IL36RN Mouse

Sign In for Pricing
View Details
IL36RN Mouse
OM296370-02 2 µg

IL36RN Mouse

Sign In for Pricing
View Details