Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3D1 Peptide - middle region

AP3D1 Peptide - middle region

Product Specifications

Product Name Alternative

ADTD, hBLVR

UniProt

O14617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AP3D1 Rabbit Polyclonal Antibody (orb589431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001248755.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RplT Antibody
orb826721 2 mg

RplT Antibody

Sign In for Pricing
View Details
Mob3a Rat siRNA Oligo Duplex (Locus ID 362833)
SR511734 1 Kit

Mob3a Rat siRNA Oligo Duplex (Locus ID 362833)

Sign In for Pricing
View Details
HOXA9 antibody
70R-8438 100 µL

HOXA9 antibody

Sign In for Pricing
View Details
Phospho-JAK2 (Tyr570) ELISA Kit
EKA51114 192 Tests

Phospho-JAK2 (Tyr570) ELISA Kit

Sign In for Pricing
View Details
LOC342443 Human qPCR Primer Pair (XM_292555)
HP221484 200 Reactions

LOC342443 Human qPCR Primer Pair (XM_292555)

Sign In for Pricing
View Details
VE-Cadherin Antibody [K17A2]
C15757-01 20 µL

VE-Cadherin Antibody [K17A2]

Sign In for Pricing
View Details