AP3D1 Peptide - middle region
AP3D1 Peptide - middle region
Product Specifications
Product Name Alternative
ADTD, hBLVR
UniProt
O14617
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AP3D1 Rabbit Polyclonal Antibody (orb589431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001248755.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDID
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6203671-01 0.1 mL
TBX18 (T-box Transcription Factor TBX18, T-box Protein 18) (MaxLight 490)
Sign In for Pricing
View Details MBS6203671-02 5x 0.1 mL
TBX18 (T-box Transcription Factor TBX18, T-box Protein 18) (MaxLight 490)
Sign In for Pricing
View Details 
A00053-2-Fluoro550 100 µg/Vial
Anti-CXCL12 Antibody Fluoro550 Conjugated
Sign In for Pricing
View Details