Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETNPPL Peptide - middle region

ETNPPL Peptide - middle region

Product Specifications

Product Name Alternative

AGXT2L1

UniProt

Q8TBG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETNPPL Rabbit Polyclonal Antibody (orb589521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001140062.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIP-1 (phospho Ser736) Polyclonal Antibody
MBS8586038-01 0.1 mg

GRIP-1 (phospho Ser736) Polyclonal Antibody

Sign In for Pricing
View Details
GRIP-1 (phospho Ser736) Polyclonal Antibody
MBS8586038-02 0.1 mL (AF405L)

GRIP-1 (phospho Ser736) Polyclonal Antibody

Sign In for Pricing
View Details
GRIP-1 (phospho Ser736) Polyclonal Antibody
MBS8586038-03 0.1 mL (AF405S)

GRIP-1 (phospho Ser736) Polyclonal Antibody

Sign In for Pricing
View Details
GRIP-1 (phospho Ser736) Polyclonal Antibody
MBS8586038-04 0.1 mL (AF610)

GRIP-1 (phospho Ser736) Polyclonal Antibody

Sign In for Pricing
View Details
GRIP-1 (phospho Ser736) Polyclonal Antibody
MBS8586038-05 0.1 mL (AF635)

GRIP-1 (phospho Ser736) Polyclonal Antibody

Sign In for Pricing
View Details
GRIP-1 (phospho Ser736) Polyclonal Antibody
MBS8586038-06 0.1 mL (APC)

GRIP-1 (phospho Ser736) Polyclonal Antibody

Sign In for Pricing
View Details