Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA3 Peptide - middle region

ITGA3 Peptide - middle region

Product Specifications

Product Name Alternative

VL3A, CD49C, FRP-2, GAPB3, ILNEB, MSK18, VCA-2, VLA3a, GAP-B3

UniProt

Q59F03

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITGA3 Rabbit Polyclonal Antibody (orb589575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002195.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P47 phox (NCF1, NOXO2, p47phox, neutrophil cytosolic factor 1, 47kD, chronic granulomatous disease, autosomal 1, Neutrophil cytosolic factor-1 (47kD) (MaxLight 750) discontinued
P1001-24G-ML750 100 µL

P47 phox (NCF1, NOXO2, p47phox, neutrophil cytosolic factor 1, 47kD, chronic granulomatous disease, autosomal 1, Neutrophil cytosolic factor-1 (47kD) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis dapA Protein (aa 1-286) (strain D/UW-3/Cx)
VAng-Lsx6637-50gEcoli 50 µg (E. coli)

Recombinant Chlamydophila Trachomatis dapA Protein (aa 1-286) (strain D/UW-3/Cx)

Sign In for Pricing
View Details
ING2 (Inhibitor of Growth Protein 2) (MaxLight 650)
MBS6222762-01 0.1 mL

ING2 (Inhibitor of Growth Protein 2) (MaxLight 650)

Sign In for Pricing
View Details
ING2 (Inhibitor of Growth Protein 2) (MaxLight 650)
MBS6222762-02 5x 0.1 mL

ING2 (Inhibitor of Growth Protein 2) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Protein Kinase B Alpha (PKBa) ELISA Kit
MBS2704298-01 24 Strip Well

Mouse Protein Kinase B Alpha (PKBa) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Kinase B Alpha (PKBa) ELISA Kit
MBS2704298-02 48 Well

Mouse Protein Kinase B Alpha (PKBa) ELISA Kit

Sign In for Pricing
View Details