Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DQA1 Peptide - middle region

HLA-DQA1 Peptide - middle region

Product Specifications

Product Name Alternative

CD, GSE, DQ-A1, CELIAC1, HLA-DQA

UniProt

P01909

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DQA1 Rabbit Polyclonal Antibody (orb589616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002113.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish EH Domain-Containing Protein 3 (EHD3) ELISA Kit
MBS9396903 Inquire

Fish EH Domain-Containing Protein 3 (EHD3) ELISA Kit

Sign In for Pricing
View Details
BTLA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV676287 1.0 µg DNA

BTLA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RCOR3 Protein Vector (Human) (pPM-C-His)
PV034784 500 ng

RCOR3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GSK3B Antibody
orb572373 100 µL

GSK3B Antibody

Sign In for Pricing
View Details
mmu-miR-7082-3p miRNA Agomir
MBS8314920-01 5 nmol

mmu-miR-7082-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-7082-3p miRNA Agomir
MBS8314920-02 10 nmol

mmu-miR-7082-3p miRNA Agomir

Sign In for Pricing
View Details