Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DQA1 Peptide - middle region

HLA-DQA1 Peptide - middle region

Product Specifications

Product Name Alternative

CD, GSE, DQ-A1, CELIAC1, HLA-DQA

UniProt

P01909

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DQA1 Rabbit Polyclonal Antibody (orb589616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002113.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE Polyclonal Antibody, Cy7 Conjugated
bs-0439R-Cy7-01 20 µL

ACE Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ACE Polyclonal Antibody, Cy7 Conjugated
bs-0439R-Cy7-02 100 µL

ACE Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Test tubes for Electrothermal Omni reaction station OS1025 24 x 150mm 22 thread
HEA5608 1 Each

Test tubes for Electrothermal Omni reaction station OS1025 24 x 150mm 22 thread

Sign In for Pricing
View Details
TAS2R42 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2336106 1.0 µg DNA

TAS2R42 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Kappa Chain Antibody - AP Conjugated
OARA04618-1MG 1 mg

Human Kappa Chain Antibody - AP Conjugated

Sign In for Pricing
View Details
Human PMAIP1 qPCR Primer Pair
QH04813S 200 Tests

Human PMAIP1 qPCR Primer Pair

Sign In for Pricing
View Details