Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CISH Peptide - middle region

CISH Peptide - middle region

Product Specifications

Product Name Alternative

CIS, G18, SOCS, CIS-1, BACTS2

UniProt

Q9NSE2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CISH Rabbit Polyclonal Antibody (orb589623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_037456.5

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ube2z shRNA (UAS) - Lentiviral mouse Ube2z shRNA (UAS) plasmid
GTR15281599 1 Vial

Lentiviral mouse Ube2z shRNA (UAS) - Lentiviral mouse Ube2z shRNA (UAS) plasmid

Sign In for Pricing
View Details
3- ((4-bromophenoxy) methyl) -4-phenyl-1,2,4-triazoline-5-thione
GQA19408 250 mg

3- ((4-bromophenoxy) methyl) -4-phenyl-1,2,4-triazoline-5-thione

Sign In for Pricing
View Details
FIBP Antibody
orb39578-01 50 μL

FIBP Antibody

Sign In for Pricing
View Details
FIBP Antibody
orb39578-02 100 µL

FIBP Antibody

Sign In for Pricing
View Details
Anti-Mullerian Hormone
545149 200 µL

Anti-Mullerian Hormone

Sign In for Pricing
View Details
BCL2/Adenovirus E1B 19kD Protein-Interacting Protein 3, Recombinant, Mouse, aa1-156, His-Tag (Bnip3)
517819-01 20 µg

BCL2/Adenovirus E1B 19kD Protein-Interacting Protein 3, Recombinant, Mouse, aa1-156, His-Tag (Bnip3)

Sign In for Pricing
View Details