Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CISH Peptide - middle region

CISH Peptide - middle region

Product Specifications

Product Name Alternative

CIS, G18, SOCS, CIS-1, BACTS2

UniProt

Q9NSE2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CISH Rabbit Polyclonal Antibody (orb589623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_037456.5

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMCA C2 Maleimide
503-AAT 5 mg

AMCA C2 Maleimide

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF740 conjugate, 0.1mg/mL
BNC742265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human FAM172A Protein (His Tag)
PKSH033551-01 10 µg

Recombinant Human FAM172A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FAM172A Protein (His Tag)
PKSH033551-02 50 µg

Recombinant Human FAM172A Protein (His Tag)

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), Biotin conjugate, 0.1mg/mL
BNCB0391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]
TA806834AM 100 µL

PD1 (PDCD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details