Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPAB Peptide - C-terminal region

HNRNPAB Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABBP1, HNRPAB

UniProt

Q99729

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPAB Rabbit Polyclonal Antibody (orb588406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112556

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r123 Mouse Gene Knockout Kit (CRISPR)
KN518925 1 Kit

Vmn1r123 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Taf1d Mouse Gene Knockout Kit (CRISPR)
KN517144 1 Kit

Taf1d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Fluoro-5-nitrobenzoic Acid
TRC-F593775-5G 5 g

2-Fluoro-5-nitrobenzoic Acid

Sign In for Pricing
View Details
Zbtb18 Mouse Gene Knockout Kit (CRISPR)
KN519596 1 Kit

Zbtb18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL3RB (CSF2RB) pTyr766 Rabbit Polyclonal Antibody
AP12630PU-N 400 µL

IL3RB (CSF2RB) pTyr766 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAB37 (NM_001163990) Human Over-expression Lysate
LC431148 20 µg

RAB37 (NM_001163990) Human Over-expression Lysate

Sign In for Pricing
View Details