Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPAB Peptide - C-terminal region

HNRNPAB Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABBP1, HNRPAB

UniProt

Q99729

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPAB Rabbit Polyclonal Antibody (orb588406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112556

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC2 (NM_181471) Human Recombinant Protein
TP320036 20 µg

RFC2 (NM_181471) Human Recombinant Protein

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pipotiazine Palmitate
TRC-P490700-50MG 50 mg

Pipotiazine Palmitate

Sign In for Pricing
View Details
High frequency desktop ultrasonic Cleaner BULC-509
BULC-509 Each

High frequency desktop ultrasonic Cleaner BULC-509

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF594 conjugate, 0.1mg/mL
BNC942004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein
TP307594L 1 mg

ZFP200 (ZNF200) (NM_003454) Human Recombinant Protein

Sign In for Pricing
View Details