POLE2 Peptide - middle region
POLE2 Peptide - middle region
Product Specifications
Product Name Alternative
DPE2
UniProt
P56282
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLE2 Rabbit Polyclonal Antibody (orb588422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001184259
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEVLEKLRI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7472003 1.0 µg DNA
Cct6a sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 
036680-ML650 100 µL
HOXA1, NT (HOXA1, HOX1F, Homeobox protein Hox-A1, Homeobox protein Hox-1F) (MaxLight 650) discontinued
Sign In for Pricing
View Details