Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLE2 Peptide - middle region

POLE2 Peptide - middle region

Product Specifications

Product Name Alternative

DPE2

UniProt

P56282

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLE2 Rabbit Polyclonal Antibody (orb588422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001184259

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEVLEKLRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOAT1 Antibody
ABD7779 100 µg

SOAT1 Antibody

Sign In for Pricing
View Details
C1orf146 Polyclonal Antibody, PerCP Conjugated
bs-15024R-PerCP 100 µL

C1orf146 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Pantothenate Kinase 3 (Pantothenic Acid Kinase 3, PANK3, hPanK3) (FITC)
MBS6491925-01 0.2 mL

Pantothenate Kinase 3 (Pantothenic Acid Kinase 3, PANK3, hPanK3) (FITC)

Sign In for Pricing
View Details
Pantothenate Kinase 3 (Pantothenic Acid Kinase 3, PANK3, hPanK3) (FITC)
MBS6491925-02 5x 0.2 mL

Pantothenate Kinase 3 (Pantothenic Acid Kinase 3, PANK3, hPanK3) (FITC)

Sign In for Pricing
View Details
CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (FITC)
MBS6174770-01 0.1 mL

CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (FITC)

Sign In for Pricing
View Details
CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (FITC)
MBS6174770-02 5x 0.1 mL

CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (FITC)

Sign In for Pricing
View Details