Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIFA Peptide - middle region

TIFA Peptide - middle region

Product Specifications

Product Name Alternative

T2BP, T6BP, TIFAA

UniProt

Q96CG3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIFA Rabbit Polyclonal Antibody (orb589371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_443096.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SERPINB6 Pre-designed siRNA Set B
SI014573B 1 Each

Human SERPINB6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Sox6 qPCR Primer Pair
QM05234S 200 Tests

Mouse Sox6 qPCR Primer Pair

Sign In for Pricing
View Details
Human B-Lymphocyte Activation Antigen B7-1 (LAB7-1) ELISA Kit
EKN50172 96 Tests

Human B-Lymphocyte Activation Antigen B7-1 (LAB7-1) ELISA Kit

Sign In for Pricing
View Details
1/2 inch wide x 500 inch Lime Labeling Tape
TAP1192 1 Each

1/2 inch wide x 500 inch Lime Labeling Tape

Sign In for Pricing
View Details
TRNAN15 sgRNA CRISPR Lentivector (Human) (Target 1)
K2507902 1.0 µg DNA

TRNAN15 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GPR88 (NM_022049) Human Tagged ORF Clone
RG218133 10 µg

GPR88 (NM_022049) Human Tagged ORF Clone

Sign In for Pricing
View Details