Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIFA Peptide - middle region

TIFA Peptide - middle region

Product Specifications

Product Name Alternative

T2BP, T6BP, TIFAA

UniProt

Q96CG3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIFA Rabbit Polyclonal Antibody (orb589371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_443096.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitrophenyl b-D-galactopyranoside
M-1620.0025 25.0g

2-Nitrophenyl b-D-galactopyranoside

Sign In for Pricing
View Details
Rabbit Anti-Smad2 antibody
SLM-52223R-01 50 µL

Rabbit Anti-Smad2 antibody

Sign In for Pricing
View Details
Rabbit Anti-Smad2 antibody
SLM-52223R-02 100 µL

Rabbit Anti-Smad2 antibody

Sign In for Pricing
View Details
Stat5a discontinued
347700-01 100 µL

Stat5a discontinued

Sign In for Pricing
View Details
Stat5a discontinued
347700-02 200 µL

Stat5a discontinued

Sign In for Pricing
View Details
Rab4b (NM_029391) Mouse Untagged Clone
MC209275 10 µg

Rab4b (NM_029391) Mouse Untagged Clone

Sign In for Pricing
View Details