RABAC1 Peptide - N-terminal region
RABAC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PRA1, YIP3, PRAF1
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RABAC1 Rabbit Polyclonal Antibody (orb589439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006414.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PT1-MY2073-100ug 100 µg
Monoclonal Anti-Human p-tau181 Antibody, Mouse IgG2a (8D8C10) (MALS verified)
Sign In for Pricing
View Details 
BNC473089-500 1x 500 µL
MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA751275 100 µL
Eph receptor A2 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details