Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABAC1 Peptide - N-terminal region

RABAC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PRA1, YIP3, PRAF1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RABAC1 Rabbit Polyclonal Antibody (orb589439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006414.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI2 Human Gene Knockout Kit (CRISPR)
KN423889 1 Kit

PADI2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR559226 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Recombinant Mouse Clusterin/ApoJ Protein (His Tag)
PKSM040656-01 50 µg

Recombinant Mouse Clusterin/ApoJ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Clusterin/ApoJ Protein (His Tag)
PKSM040656-02 100 µg

Recombinant Mouse Clusterin/ApoJ Protein (His Tag)

Sign In for Pricing
View Details
Bovine Resistin (RETN) ELISA Kit
RDR-RETN-b-01 96 Tests

Bovine Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details
Bovine Resistin (RETN) ELISA Kit
RDR-RETN-b-02 48 Tests

Bovine Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details