Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM19A2 Peptide - middle region

FAM19A2 Peptide - middle region

Product Specifications

Product Name Alternative

TAFA2, TAFA-2

UniProt

Q8N3H0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM19A2 Rabbit Polyclonal Antibody (orb55812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_848634.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA4 (11B16) Mouse Monoclonal antibody
E28PE1357 100 µL

GATA4 (11B16) Mouse Monoclonal antibody

Sign In for Pricing
View Details
1-Amino-4-oxocyclohexanecarboxylic acid ethylene ketal
sc-273203 250 mg

1-Amino-4-oxocyclohexanecarboxylic acid ethylene ketal

Sign In for Pricing
View Details
2- (2-Oxopiperidin-1-yl) propanoic acid
WQA12992-01 100 mg

2- (2-Oxopiperidin-1-yl) propanoic acid

Sign In for Pricing
View Details
2- (2-Oxopiperidin-1-yl) propanoic acid
WQA12992-02 1 g

2- (2-Oxopiperidin-1-yl) propanoic acid

Sign In for Pricing
View Details
Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit
MBS2024739-01 24 Strip Well

Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit

Sign In for Pricing
View Details
Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit
MBS2024739-02 48 Well

Human Pancreas Specific Transcription Factor 1a (PTF1a) ELISA Kit

Sign In for Pricing
View Details