FAM19A2 Peptide - middle region
FAM19A2 Peptide - middle region
Product Specifications
Product Name Alternative
TAFA2, TAFA-2
UniProt
Q8N3H0
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM19A2 Rabbit Polyclonal Antibody (orb55812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_848634.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QKATKGKLLIIIFIVTLWGKVVSSANHHKAHHVKTGTCEVVALHRCCNKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2925664-01 20 µg
Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (HSD3B1)
Sign In for Pricing
View Details orb2925664-02 100 µg
Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (HSD3B1)
Sign In for Pricing
View Details 
abx273351-01 200 µL
Heat Shock Protein Beta 6 (HSPb6) Antibody (Biotin)
Sign In for Pricing
View Details abx273351-02 1 mL
Heat Shock Protein Beta 6 (HSPb6) Antibody (Biotin)
Sign In for Pricing
View Details