Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Peptide - N-terminal region

MOB1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MOB1, MATS1, Mob4B, C2orf6, MOBK1B, MOBKL1B

UniProt

Q9H8S9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB1A Rabbit Polyclonal Antibody (orb589520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060691.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)
MBS1312784-01 0.02 mg (E-Coli)

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)

Sign In for Pricing
View Details
Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)
MBS1312784-02 0.02 mg (Yeast)

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)

Sign In for Pricing
View Details
Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)
MBS1312784-03 0.1 mg (E-Coli)

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)

Sign In for Pricing
View Details
Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)
MBS1312784-04 0.1 mg (Yeast)

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)

Sign In for Pricing
View Details
Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)
MBS1312784-05 0.02 mg (Baculovirus)

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)

Sign In for Pricing
View Details
Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)
MBS1312784-06 0.02 mg (Mammalian-Cell)

Recombinant Danio rerio Adenylyltransferase and sulfurtransferase MOCS3 (mocs3)

Sign In for Pricing
View Details