Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1A Peptide - N-terminal region

MOB1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MOB1, MATS1, Mob4B, C2orf6, MOBK1B, MOBKL1B

UniProt

Q9H8S9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB1A Rabbit Polyclonal Antibody (orb589520) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060691.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene AM NH₂
H16020002.5G 5 g

Polystyrene AM NH₂

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL
BNCB2884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD50/ICAM-3 Protein (His Tag)
PKSH031675-01 100 µg

Recombinant Human CD50/ICAM-3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD50/ICAM-3 Protein (His Tag)
PKSH031675-02 1 mg

Recombinant Human CD50/ICAM-3 Protein (His Tag)

Sign In for Pricing
View Details
VIM Antibody
F48163-0.4ML 0.4 mL

VIM Antibody

Sign In for Pricing
View Details
ICG-Sulfo-EG4-OSu
183-AAT 1 mg

ICG-Sulfo-EG4-OSu

Sign In for Pricing
View Details