Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1R Peptide - C-terminal region

HIP1R Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIP3, HIP12, ILWEQ

UniProt

O75146

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1R Rabbit Polyclonal Antibody (orb589538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001290026.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prame 3'UTR Luciferase Stable Cell Line
TU216718 1.0 mL

Prame 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mucin-5AC (MUC5AC) Antibody
abx431441 200 µL

Mucin-5AC (MUC5AC) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ADA2 beta Antibody
NBP2-86954 100 µL

Rabbit Polyclonal ADA2 beta Antibody

Sign In for Pricing
View Details
Water Quality Test Kit: Alkalinity, Chloride, Hardness, Iron, pH, Sulphite
HI3817BP 1 Each

Water Quality Test Kit: Alkalinity, Chloride, Hardness, Iron, pH, Sulphite

Sign In for Pricing
View Details
LYN Peptide
orb1233921 0.1 mg

LYN Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal CNOT6 Antibody [Allophycocyanin]
NBP2-99135APC 0.1 mL

Rabbit Polyclonal CNOT6 Antibody [Allophycocyanin]

Sign In for Pricing
View Details