Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIP1R Peptide - C-terminal region

HIP1R Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIP3, HIP12, ILWEQ

UniProt

O75146

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIP1R Rabbit Polyclonal Antibody (orb589538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001290026.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CLU/Clusterin Antibody (R1N14)
RHC84101 100 μg

Anti-CLU/Clusterin Antibody (R1N14)

Sign In for Pricing
View Details
Zfp148 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV662181 1.0 µg DNA

Zfp148 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YBHP Polyclonal Antibody
MBS7163292 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YBHP Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HA Tag Antibody-HRP (6T48)
TMAY-00029H-01 20 µg

Anti-HA Tag Antibody-HRP (6T48)

Sign In for Pricing
View Details
Anti-HA Tag Antibody-HRP (6T48)
TMAY-00029H-02 100 µg

Anti-HA Tag Antibody-HRP (6T48)

Sign In for Pricing
View Details
Hibadh (BC003914) Mouse Untagged Clone
MC200324 10 µg

Hibadh (BC003914) Mouse Untagged Clone

Sign In for Pricing
View Details