Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH2L Peptide - middle region

GPATCH2L Peptide - middle region

Product Specifications

Product Name Alternative

C14orf118

UniProt

Q9NW75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPATCH2L Rabbit Polyclonal Antibody (orb55813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060396.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENMSECETSSVCSSSDTGLFTNDEGRQGDDEQSDWFYEGECVPGFTVPNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Interleukin 18 (IL18)
TRV-0016073-01 20 µL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
TRV-0016073-02 100 µL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
TRV-0016073-03 200 µL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 18 (IL18)
TRV-0016073-04 1 mL

Monoclonal Antibody to Interleukin 18 (IL18)

Sign In for Pricing
View Details
SDF2L1 Rabbit Polyclonal Antibody (APC)
orb2592087 100 µg

SDF2L1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Human ABCB4 Knockout A549 cell line
GTR15403022 1 Vial

Human ABCB4 Knockout A549 cell line

Sign In for Pricing
View Details