GPATCH2L Peptide - middle region
GPATCH2L Peptide - middle region
Product Specifications
Product Name Alternative
C14orf118
UniProt
Q9NW75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPATCH2L Rabbit Polyclonal Antibody (orb55813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060396.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENMSECETSSVCSSSDTGLFTNDEGRQGDDEQSDWFYEGECVPGFTVPNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
247473-ML650 100 µL
IGFBP6 (Insulin-like Growth Factor Binding Protein 6, IBP6) (MaxLight 650)
Sign In for Pricing
View Details MBS9334437-01 48 Well
Mouse Zinc finger protein 76, ZNF76 ELISA Kit
Sign In for Pricing
View Details