Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB4A Peptide - middle region

TUBB4A Peptide - middle region

Product Specifications

Product Name Alternative

DYT4, TUBB4, beta-5

UniProt

P04350

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBB4A Rabbit Polyclonal Antibody (orb589553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001276052.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-NFAT3 Antibody, Affinity Purified
A302-769A-T 2 µg

Rabbit anti-NFAT3 Antibody, Affinity Purified

Sign In for Pricing
View Details
Fam71e1 3'UTR Lenti-reporter-Luc Vector
20095084 1.0 µg

Fam71e1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
AdmiRa-rno-miR-196c-3p Virus
mr0618 250 µL

AdmiRa-rno-miR-196c-3p Virus

Sign In for Pricing
View Details
4930563M21Rik Mouse qPCR Primer Pair (NM_183111)
MP213907 200 Reactions

4930563M21Rik Mouse qPCR Primer Pair (NM_183111)

Sign In for Pricing
View Details
PRKAG3 AAV siRNA Pooled Vector
37629161 1.0 µg

PRKAG3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Prkci (NM_032059) Rat Tagged ORF Clone
RR205182 10 µg

Prkci (NM_032059) Rat Tagged ORF Clone

Sign In for Pricing
View Details