POLD1 Peptide - N-terminal region
POLD1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDC2, MDPL, POLD, CRCS10
UniProt
P28340
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLD1 Rabbit Polyclonal Antibody (orb589556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001243778.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RK06753 96 Tests
Human Gamma-secretase subunit APH-1A (APH1A) ELISA Kit
Sign In for Pricing
View Details MBS1364898-01 0.02 mg (E-Coli)
Recombinant Shigella sonnei Uronate isomerase (uxaC)
Sign In for Pricing
View Details MBS1364898-02 0.02 mg (Yeast)
Recombinant Shigella sonnei Uronate isomerase (uxaC)
Sign In for Pricing
View Details MBS1364898-03 0.1 mg (E-Coli)
Recombinant Shigella sonnei Uronate isomerase (uxaC)
Sign In for Pricing
View Details MBS1364898-04 0.1 mg (Yeast)
Recombinant Shigella sonnei Uronate isomerase (uxaC)
Sign In for Pricing
View Details MBS1364898-05 0.02 mg (Baculovirus)
Recombinant Shigella sonnei Uronate isomerase (uxaC)
Sign In for Pricing
View Details