Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLD1 Peptide - N-terminal region

POLD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC2, MDPL, POLD, CRCS10

UniProt

P28340

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLD1 Rabbit Polyclonal Antibody (orb589556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243778.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Skin
CS544249 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
Mouse Slc10a2 Antibody (N-term) Blocking Peptide
MBS9223609-01 0.5 mg

Mouse Slc10a2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse Slc10a2 Antibody (N-term) Blocking Peptide
MBS9223609-02 5x 0.5 mg

Mouse Slc10a2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
SLC16A8 (NM_013356) Human Tagged ORF Clone Lentiviral Particle
RC216789L1V 200 µL

SLC16A8 (NM_013356) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Anti-Human ABCA7 pAb
PA11704-01 50 μL

Rabbit Anti-Human ABCA7 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ABCA7 pAb
PA11704-02 100 μL

Rabbit Anti-Human ABCA7 pAb

Sign In for Pricing
View Details