Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC4 Peptide - middle region

ZCCHC4 Peptide - middle region

Product Specifications

Product Name Alternative

ZGRF4, HSPC052

UniProt

Q9H5U6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZCCHC4 Rabbit Polyclonal Antibody (orb589558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079212.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUTA Lentiviral Activation Particles (m2)
sc-426681-LAC-2 200 µL

CUTA Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Mouse Anti-Type II Collagen AutoAntibody ELISA kit
GTR10413716 96 Well

Mouse Anti-Type II Collagen AutoAntibody ELISA kit

Sign In for Pricing
View Details
FOXO3 Peptide
5813P 0.05 mg

FOXO3 Peptide

Sign In for Pricing
View Details
Atrnl1 siRNA Oligos set (Mouse)
12836174 3x 5 nmol

Atrnl1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal TDRKH Antibody (PCRP-TDRKH-1H2) [Alexa Fluor 350]
NBP3-14276AF350 0.1 mL

Mouse Monoclonal TDRKH Antibody (PCRP-TDRKH-1H2) [Alexa Fluor 350]

Sign In for Pricing
View Details
Calpain 14 Rabbit Polyclonal Antibody (HRP)
orb470168 100 µL

Calpain 14 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details