Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC4 Peptide - middle region

ZCCHC4 Peptide - middle region

Product Specifications

Product Name Alternative

ZGRF4, HSPC052

UniProt

Q9H5U6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZCCHC4 Rabbit Polyclonal Antibody (orb589558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079212.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TAF10 Polyclonal Antibody
MBS7189692 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) TAF10 Polyclonal Antibody

Sign In for Pricing
View Details
Laccase, Recombinant Microbial (High activity)
HY-P2890A 1 Each

Laccase, Recombinant Microbial (High activity)

Sign In for Pricing
View Details
RPL27P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1953708 1.0 µg DNA

RPL27P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
OPEF01811-1MG - MDMA Antigen : BSA
OPEF01811-1MG 1 mg

OPEF01811-1MG - MDMA Antigen : BSA

Sign In for Pricing
View Details
Polyclonal kallikrein 6 Antibody (internal region)
APG00920G 0.1mg

Polyclonal kallikrein 6 Antibody (internal region)

Sign In for Pricing
View Details
EFTUD2 Protein Vector (Mouse) (pPB-N-His)
PV174731 500 ng

EFTUD2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details