Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNB1 Peptide - middle region

CHRNB1 Peptide - middle region

Product Specifications

Product Name Alternative

ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS

UniProt

P11230

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNB1 Rabbit Polyclonal Antibody (orb589560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000738.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLILAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAE

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG11 Human shRNA Plasmid Kit (Locus ID 2791)
TL319559 1 Kit

GNG11 Human shRNA Plasmid Kit (Locus ID 2791)

Sign In for Pricing
View Details
DRAK1, NT (Serine/Threonine protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, STK17A) (MaxLight 550) discontinued
D9334-01G-ML550 100 µL

DRAK1, NT (Serine/Threonine protein Kinase 17A, DAP Kinase-related Apoptosis-inducing Protein Kinase 1, STK17A) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant human ETFB protein
ATGP1047-050 50 µg

Recombinant human ETFB protein

Sign In for Pricing
View Details
GRK2 Antibody
orb3161303-01 50 µL

GRK2 Antibody

Sign In for Pricing
View Details
GRK2 Antibody
orb3161303-02 100 µL

GRK2 Antibody

Sign In for Pricing
View Details
Interleukin-2 Antibody / IL-2
V5041-100UG 100 µg

Interleukin-2 Antibody / IL-2

Sign In for Pricing
View Details