Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNB1 Peptide - middle region

CHRNB1 Peptide - middle region

Product Specifications

Product Name Alternative

ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS

UniProt

P11230

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNB1 Rabbit Polyclonal Antibody (orb589560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000738.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLILAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAE

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC541471 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV809032 1.0 µg DNA

LOC541471 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
TLR Detection Set
PSI-1806 1 Set

TLR Detection Set

Sign In for Pricing
View Details
Rabbit Polyclonal NKCC2/SLC12A1 Antibody
NBP1-57622 100 µL

Rabbit Polyclonal NKCC2/SLC12A1 Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 184 (ZNF184) Antibody
abx036617-01 100 µg

Zinc Finger Protein 184 (ZNF184) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 184 (ZNF184) Antibody
abx036617-02 1 mg

Zinc Finger Protein 184 (ZNF184) Antibody

Sign In for Pricing
View Details
RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (FITC)
128181-FITC 100 µL

RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (FITC)

Sign In for Pricing
View Details