Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC9 Peptide - middle region

ZDHHC9 Peptide - middle region

Product Specifications

Product Name Alternative

CGI89, DHHC9, MMSA1, MRXSZ, ZNF379, ZNF380, CXorf11, ZDHHC10

UniProt

Q9Y397

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZDHHC9 Rabbit Polyclonal Antibody (orb589561) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001008223.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI35 Recombinant Protein (Mouse)
RP142994 100 µg

IFI35 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
4-Pyridinealdoxime
MBS6052372-01 1 g

4-Pyridinealdoxime

Sign In for Pricing
View Details
4-Pyridinealdoxime
MBS6052372-02 5x 1 g

4-Pyridinealdoxime

Sign In for Pricing
View Details
SEC6 Recombinant Protein Antigen
NBP2-55179PEP 100 µL

SEC6 Recombinant Protein Antigen

Sign In for Pricing
View Details
Lentiviral mouse Mog shRNA (UAS) - Lentiviral mouse Mog shRNA (UAS) plasmid
GTR15210343 1 Vial

Lentiviral mouse Mog shRNA (UAS) - Lentiviral mouse Mog shRNA (UAS) plasmid

Sign In for Pricing
View Details
Oligodendrocyte Specific Protein (CLDN11) (NM_001185056) Human Tagged ORF Clone
RG230958 10 µg

Oligodendrocyte Specific Protein (CLDN11) (NM_001185056) Human Tagged ORF Clone

Sign In for Pricing
View Details