Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP1 Peptide - C-terminal region

AQP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CO, CHIP28, AQP-CHIP

UniProt

P29972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AQP1 Rabbit Polyclonal Antibody (orb589563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001171989.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RG7388
A3763-10 10 mg

RG7388

Sign In for Pricing
View Details
RNF166 Human shRNA Plasmid Kit (Locus ID 115992)
TR301954 1 Kit

RNF166 Human shRNA Plasmid Kit (Locus ID 115992)

Sign In for Pricing
View Details
Dok-2 (phospho Tyr299) Polyclonal Antibody
MBS8519859-01 0.1 mg

Dok-2 (phospho Tyr299) Polyclonal Antibody

Sign In for Pricing
View Details
Dok-2 (phospho Tyr299) Polyclonal Antibody
MBS8519859-02 0.1 mL (AF635)

Dok-2 (phospho Tyr299) Polyclonal Antibody

Sign In for Pricing
View Details
Dok-2 (phospho Tyr299) Polyclonal Antibody
MBS8519859-03 0.1 mL (AF610)

Dok-2 (phospho Tyr299) Polyclonal Antibody

Sign In for Pricing
View Details
Dok-2 (phospho Tyr299) Polyclonal Antibody
MBS8519859-04 0.1 mL (AF405S)

Dok-2 (phospho Tyr299) Polyclonal Antibody

Sign In for Pricing
View Details