Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAM1 Peptide - middle region

PRAM1 Peptide - middle region

Product Specifications

Product Name Alternative

PRAM-1, PML-RAR

UniProt

Q96QH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAM1 Rabbit Polyclonal Antibody (orb589565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115528.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFQDRQPEDIPQVPDEIYELYDDVEPRDDSSPSPKGRDEAPSVQQAARRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRY discontinued
347097-01 100 µL

SRY discontinued

Sign In for Pricing
View Details
SRY discontinued
347097-02 200 µL

SRY discontinued

Sign In for Pricing
View Details
Lentiviral human PGM5 shRNA (UAS) - Lentiviral human PGM5 shRNA (UAS) plasmid
GTR15086323 1 Vial

Lentiviral human PGM5 shRNA (UAS) - Lentiviral human PGM5 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-Human CD14 Antibody (28C5), FITC
FHC33711 100 Tests

Anti-Human CD14 Antibody (28C5), FITC

Sign In for Pricing
View Details
mmu-miR-599 miRNA Inhibitor
MIM02326 2x 5.0 nmol

mmu-miR-599 miRNA Inhibitor

Sign In for Pricing
View Details
Anti-Zebrafish Caveolin 3/CAV3 Antibody, Dylight550 Conjugate
DZ00990-1-Dylight550 200 µL

Anti-Zebrafish Caveolin 3/CAV3 Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details