Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAM1 Peptide - middle region

PRAM1 Peptide - middle region

Product Specifications

Product Name Alternative

PRAM-1, PML-RAR

UniProt

Q96QH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAM1 Rabbit Polyclonal Antibody (orb589565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115528.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFQDRQPEDIPQVPDEIYELYDDVEPRDDSSPSPKGRDEAPSVQQAARRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RALBP1 Rabbit Polyclonal Antibody
orb381999-01 30 µL

RALBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RALBP1 Rabbit Polyclonal Antibody
orb381999-02 50 μL

RALBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RALBP1 Rabbit Polyclonal Antibody
orb381999-03 100 µL

RALBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RALBP1 Rabbit Polyclonal Antibody
orb381999-04 200 µL

RALBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HDGF, 1-100aa, Human, E Coli
MBS203732-01 0.02 mg

HDGF, 1-100aa, Human, E Coli

Sign In for Pricing
View Details
HDGF, 1-100aa, Human, E Coli
MBS203732-02 0.1 mg

HDGF, 1-100aa, Human, E Coli

Sign In for Pricing
View Details