AVEN Peptide - middle region
AVEN Peptide - middle region
Product Specifications
Product Name Alternative
PDCD12
UniProt
Q9NQS1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AVEN Rabbit Polyclonal Antibody (orb589568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_065104.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWD
More Discoveries
Explore Other Products
Browse additional items from our catalog
244698-Biotin 100 µL
CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (Biotin)
Sign In for Pricing
View Details 
C31B-01 10 µg
Recombinant Human Integrin alpha 6 beta 4 Heterodimer (C-Flag, C-6His)
Sign In for Pricing
View Details C31B-02 50 µg
Recombinant Human Integrin alpha 6 beta 4 Heterodimer (C-Flag, C-6His)
Sign In for Pricing
View Details 
C31B-03 500 µg
Recombinant Human Integrin alpha 6 beta 4 Heterodimer (C-Flag, C-6His)
Sign In for Pricing
View Details