AVEN Peptide - middle region
AVEN Peptide - middle region
Product Specifications
Product Name Alternative
PDCD12
UniProt
Q9NQS1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AVEN Rabbit Polyclonal Antibody (orb589568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_065104.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWD
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal FBP2 Antibody [Janelia Fluor 646]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-97862JF646 0.1 mL
Rabbit Polyclonal FBP2 Antibody [Janelia Fluor 646]
Sign In for Pricing
View Details 
VAng-Cr4228-50gEcoli 50 µg (E. coli)
Recombinant HAdV-12 PV Protein (aa 1-347)
Sign In for Pricing
View Details 
CST 52928S 100 µL
Phospho-FGF Receptor 1 (Tyr653/654) (D4X3D) Rabbit Monoclonal Antibody
Sign In for Pricing
View Details YLA3113HU-01 48 Tests
Human Cartilage Associated Protein (CRTAP) ELISA Kit
Sign In for Pricing
View Details