Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNE2 Peptide - middle region

KCNE2 Peptide - middle region

Product Specifications

Product Name Alternative

LQT5, LQT6, ATFB4, MIRP1

UniProt

Q9Y6J6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNE2 Rabbit Polyclonal Antibody (orb589672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_751951.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-12/IL-35 p35 Antibody (B-T21) [DyLight 594]
NBP3-14604DL594 0.1 mL

Mouse Monoclonal IL-12/IL-35 p35 Antibody (B-T21) [DyLight 594]

Sign In for Pricing
View Details
Human Heart, 4 Parts
4074650/B 1 Each

Human Heart, 4 Parts

Sign In for Pricing
View Details
COL2A1, CT (Collagen alpha-1(II) Chain, Alpha-1 Type II Collagen, Chondrocalcin) (AP)
MBS6469754-01 0.2 mL

COL2A1, CT (Collagen alpha-1(II) Chain, Alpha-1 Type II Collagen, Chondrocalcin) (AP)

Sign In for Pricing
View Details
COL2A1, CT (Collagen alpha-1(II) Chain, Alpha-1 Type II Collagen, Chondrocalcin) (AP)
MBS6469754-02 5x 0.2 mL

COL2A1, CT (Collagen alpha-1(II) Chain, Alpha-1 Type II Collagen, Chondrocalcin) (AP)

Sign In for Pricing
View Details
6-Arm-PEG-DSPE (MW 5000)
orb3137747-01 50 mg

6-Arm-PEG-DSPE (MW 5000)

Sign In for Pricing
View Details
6-Arm-PEG-DSPE (MW 5000)
orb3137747-02 10 mg

6-Arm-PEG-DSPE (MW 5000)

Sign In for Pricing
View Details